General Information

  • ID:  hor000195
  • Uniprot ID:  O77220
  • Protein name:  Crustacean hyperglycemic hormone
  • Gene name:  CHH
  • Organism:  Macrobrachium lanchesteri (Freshwater prawn) (Palaemon lanchesteri)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macrobrachium (genus), Palaemonidae (family), Palaemonoidea (superfamily), Caridea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIV
  • Length:  72(62-133)
  • Propeptide:  MIRSSVMGPTMFLVVLLLIASHQTSAWSLDGLARIEKLLSTSSSASAASPTRGQALNLKKRAILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIVGK
  • Signal peptide:  MIRSSVMGPTMFLVVLLLIASHQTSA
  • Modification:  T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-O77220-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000195_AF2.pdbhor000195_ESM.pdb

Physical Information

Mass: 979749 Formula: C374H587N101O113S7
Absent amino acids: HTW Common amino acids: DL
pI: 4.46 Basic residues: 9
Polar residues: 17 Hydrophobic residues: 25
Hydrophobicity: -25.56 Boman Index: -14626
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 96.11
Instability Index: 2738.06 Extinction Coefficient cystines: 7825
Absorbance 280nm: 110.21

Literature

  • PubMed ID:  NA
  • Title:  NA